SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BQN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BQN8
Domain Number 1 Region: 53-180,211-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 
Domain Number 2 Region: 618-692
Classification Level Classification E-value
Superfamily EF-hand 2.68e-17
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 3 Region: 309-403
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000196
Family D-aminoacid oxidase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BQN8
Sequence length 726
Comment (tr|G5BQN8|G5BQN8_HETGA) Glycerol-3-phosphate dehydrogenase {ECO:0000256|RuleBase:RU361217} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19736 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAFHKVVKGTVLVGGGALATVLGLSQFAHYRRKQVNLAYVEAAECFEPVNREPPSREAQL
LTLRNTLEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVRY
LQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLYD
LVAGSNCLKSSYVLSKSRALEHFPMLQKDRLVGAIVYYDGQHNDARMNLAVALTAARYGA
ATANYMEVVSLLKKTDPETGREHVSGARCKDVLTGQEFDVRAKCVINATGPFTDAVRKMD
DKSAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDSPTDI
THHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHV
VDISESGLITIAGGKWTTYRSMAEDTVNAAIKVHNLKAGPSRTVGLFLQGGKDWSPTLYI
RLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGI
KEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDEKKKEKELETARRFLYY
EMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMDE
NTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVD
RSCGGL
Download sequence
Identical sequences G5BQN8
XP_004835983.1.39548 XP_004835984.1.39548 XP_004835985.1.39548 HGL_H00000308610-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]