SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BQR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BQR5
Domain Number 1 Region: 138-186
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000068
Family HLH, helix-loop-helix DNA-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BQR5
Sequence length 404
Comment (tr|G5BQR5|G5BQR5_HETGA) Spermatogenesis-and oogenesis-specific basic helix-loop-helix-containing protein 1 {ECO:0000313|EMBL:EHB11626.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_00379 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MDQQHWGHRELRLPHYELLGHPYPSLSPQAAQSPKTTWLAGAGEGFRRLSACAPCRPHRV
CDGVGLSLGLVSGSSASEDPMQVPSLAKNASAAKDPVLPRNVLSERERSGSSASEDPMQV
PSLAKNASAAKDPVLPRNVLSERERRKRISASCERLRALLPSFDGRREDMASVLEMAVQF
LRLAHSLGPGWEQHRPCPKKLRIHLSVWEHGARSIEGHVAHVAGGRYAVDPDEPGFSRRV
RPRDSGIRPDSVSGPVAHLSGCVAAGSQTRSLACLRKGWPGQAGPLDRAATSPARLAREV
ALMPALDIRSVSGLDVEVGECFPLSASPEWWPGPVEARGATPSGAPARSSPVDRAEPGFL
DDPVPSPQEPQDGPLELWGSDMDSWGLDLQDDSVDGIFADFLGC
Download sequence
Identical sequences G5BQR5
HGL_H00000404438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]