SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BVG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BVG7
Domain Number 1 Region: 109-170
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-20
Family SH3-domain 0.00075
Further Details:      
 
Domain Number 2 Region: 271-350
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 4-60
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BVG7
Sequence length 638
Comment (tr|G5BVG7|G5BVG7_HETGA) CD2-associated protein {ECO:0000313|EMBL:EHB13278.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12405 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
LVDYIVEYDCDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TDTKDDNLPIKRERHGNVASLVQRIRTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYI
PQNEDELELQVGDITDINEEVEEGWWSGTLNHKVGLFPSNFVKELEDTDDSDSLEAQDEP
DSVLTAPTSPLPSPGNGGETAPGTVTQPKKIRGIGFGDIFKDGSLKLRTRTSSSETEEKK
PEKPLIMQSLGPKTQNVEITKTDTKGKIKAKEYCRTLFDYEGSNEDEPSFKEGEIIRLIS
KETGEAGWWKGELNGKEGVFPDNFAIQIGDLDKDFPKPKKPPPPTKGPAPKPDTLAAEKK
LFPIKPEEKDENSLLEQKPKPAAPQVPPKKPTPPTKANSLLRSPGTVFPKRPEKPVPPPP
PSAKINGEISTISSKFETEPVSKPKLDSEQLSVRPKSVDLDSLIARSSKETDVVNFDDIA
SSQNLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKTLKLPKEDDSANLKPSEFKKDTCY
SPKPSVHLSTPSSGSQASAAGFLTPLEVKAKVETDDGKKISVDELRAQIIELMCIVEALK
KDHGKELEKLRKDLEEEKALRSNLEVEIEKLKKAVLSS
Download sequence
Identical sequences G5BVG7
HGL_H00000352264-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]