SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BW35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BW35
Domain Number 1 Region: 51-173
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.86e-20
Family DnaQ-like 3'-5' exonuclease 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BW35
Sequence length 185
Comment (tr|G5BW35|G5BW35_HETGA) Interferon-stimulated 20 kDa exonuclease-like 2 {ECO:0000313|EMBL:EHB13496.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10722 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSALLLNLDFAECPPKKSLEGNAKHRNFVKRQQFLEQRGFLNKKNQCPSKPCPIVDYRTR
WSGIRKHHMLKATPFKTAWSQILKILSGKVVVGHANHNDFKAPQYFHPKPLTRDTSQIPL
LNRKASCPENATMSLKTLTKKLLGWDIQAGKSGHSSVEDAQATMELYKLVEVEWEHHLAQ
NLQKN
Download sequence
Identical sequences G5BW35
HGL_H00000357202-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]