SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BX74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BX74
Domain Number 1 Region: 19-132
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 7.85e-38
Family Retrovirus capsid protein, N-terminal core domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 125-169
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000132
Family Retroviral integrase, catalytic domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BX74
Sequence length 206
Comment (tr|G5BX74|G5BX74_HETGA) Gag polyprotein {ECO:0000313|EMBL:EHB13885.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19474 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
GLTDSTVLLLRATGPPGEYGNQPLQYWPFATSDLYNWRTQHAKFSDNLRYLIQLLETVLF
THQPTWDDCQQLLQILFTVEECKRIQNEARKLVPGDSGQPTLNVDTINTSFPLSQPDWDF
NMAEEVFPTKHETAQVVAKKLLEDILPRYGFPAMLESDNGPAFISKRNLEPRWKGPYVIV
LTTPTTLKADEIASWIHYTHARPADP
Download sequence
Identical sequences G5BX74
HGL_M00000094921-20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]