SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BXY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BXY0
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 2.65e-43
Family Globins 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BXY0
Sequence length 142
Comment (tr|G5BXY0|G5BXY0_HETGA) Hemoglobin subunit theta-1 {ECO:0000313|EMBL:EHB14141.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12997 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MELSAADQAAVRALWKKMGTNVGVYATEALERTFLAFPSTKTYFPHWDLSIGSAQVKALG
QKVADALTLAVDQLYDLPGALSALSDLHAHKLRVDPANFHLLGHCLLVTLARHYPGDFSP
AMQASLDKFLSLVTSALTSKYR
Download sequence
Identical sequences G5BXY0
HGL_H00000199708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]