SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BYW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BYW8
Domain Number 1 Region: 29-248
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-57
Family Ribonuclease H 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BYW8
Sequence length 298
Comment (tr|G5BYW8|G5BYW8_HETGA) Ribonuclease {ECO:0000256|RuleBase:RU003515} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16088 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MDLSELEKDNTGRSRLSSPVPAVCREEPCVLGVDEAGRGPVLGPMVYAICYCPESRLADL
EALKVADSKTLSESERDRLFAKMEEDQDLVGWALDVLSPNLISTSMLGRVKYNLNSLSHD
TATGLIQYALDQGVKVTQVFVDTVGLPEMYQKRLQQRFPEITVTVKAKADALYPVVSAAS
ICAKVARDQAVKSWQFVEKLQDLDADYGSGYPNDPKTKAWLRRHVEPVFGFPQLVRFSWR
TAQAILEKEAEGVTWEDSATEEQEGHRRITSYFQSEGPRARAPHRYFQERGLESATAL
Download sequence
Identical sequences G5BYW8
HGL_H00000221486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]