SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BZQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BZQ2
Domain Number 1 Region: 91-187
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.54e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 266-377
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.71e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  G5BZQ2
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily PH domain-like 0.000334
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BZQ2
Sequence length 389
Comment (tr|G5BZQ2|G5BZQ2_HETGA) Neural Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:EHB14763.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10449 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MEMFQTCQVALNFANEEEAKKFRKAVTDLLSRRQRKSGPNLPMATVDIKNPEITTNRFYG
PQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLF
DMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHS
SGPPPPPARGRGAPPPPPSRAPTAAPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSG
PPPPPPPLSVTTGSVVPPPPPPPPPPPGPPPPPGLPSDGDHQVSTPAGSKAALLDQIREG
AQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQ
KRSKAIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences G5BZQ2
HGL_H00000223023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]