SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C0B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C0B7
Domain Number 1 Region: 48-184
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000233
Family ADP-ribosylating toxins 0.028
Further Details:      
 
Weak hits

Sequence:  G5C0B7
Domain Number - Region: 200-284
Classification Level Classification E-value
Superfamily Lipocalins 0.0684
Family Retinol binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5C0B7
Sequence length 421
Comment (tr|G5C0B7|G5C0B7_HETGA) Phosphatidylinositol 4-kinase type 2-alpha {ECO:0000313|EMBL:EHB14970.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09229 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MDETSPLVSPERAQPPEYTFPSGSGAHFPQAQALAAQAAAAAHAAQAQDPEFEAVVRQAE
LAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCC
FGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLAL
EKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLV
VLDYIIRNTDRGNDNWLIKYDCPMDSSTSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDS
WRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHK
QIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSASESYTQSFQSRKPFFSW
W
Download sequence
Identical sequences G5C0B7
HGL_H00000359665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]