SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C0Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C0Q8
Domain Number 1 Region: 420-503
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.84e-21
Family Canonical RBD 0.0045
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily SAP domain 0.0000000123
Family SAP domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C0Q8
Sequence length 946
Comment (tr|G5C0Q8|G5C0Q8_HETGA) Scaffold attachment factor B1 {ECO:0000313|EMBL:EHB15119.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20495 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAETLSGLGDSGAASAAALSSASSETGTRRLSDLRVIDLRAELRKRNLDSSGNKSVLMER
LKKAIEDEGGNPDEIEVTSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSL
ENLQDIDMMDISVLDEAEIDNGSVADCVEEEDADNLPESLSDSRELVEGEMKDLPEQLQE
HAVDDKETINNLDTSSSDFTILQEIEEPSLEPENEKILDILGETCKSEPVKEEGSELEQP
FAQDTSSVGPDRKLAEEEDLFGSAHPEEEEEEEQEEEEEEEEEEGDLDLASESTRAQWSE
ADTLLAVVKREPVEQTGEGARTDCEPVGLEKPVEQSSAASELPEASSQELAEAPTEAPSP
EPRDSKEDVKKFEFDACNEVPPAPKESSTSEGADQKMSSVEDDSDSKRLSREEKGHSSCS
RNFWVSGLSSMTRATDLKTLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTAEEATKCIN
HLHKTELHGKMISVEKAKNEPASKKTSEKRDSEGKKEKSSTSDRYFFPGERPLSANLKRD
DKSDRKDDSKKGEDASGEKSKDPDEKLGSSERSRATKSGSRGTERIVVMDKSKGVPVISV
KTSGSKERASKSQDRKSASREKRSVVSFDKVKEPRKSRDSESRSPVEKWTGHGRGATGRG
SDTDLSASVAWERPLRLEGQSCVETCRFLSEHCFLERCRRVKTASPGLNRAGRGILKTNE
MREQGGGQVHQPPRGRLGGNTCPVPSRRDDAYWPEAKRAALDERYHSDFSRQDRFHDFDH
RDRGRYPNHSVDRREGSRSMMGEREGQHYPERHGGPERHSRDSRDSWGYGSDKRMSEGRG
LPPPPRDRRDWGEHGRRLEDDRAWQGAADGGMIDRDHKRWQGGERSMSGHSGPGHMMNRG
GMSGRGSFAPGGASRGHVIPRGGMQGGFRGQSRGSRPSDTRFTRRY
Download sequence
Identical sequences G5C0Q8
HGL_H00000404545-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]