SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C2C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C2C1
Domain Number 1 Region: 155-475
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.74e-121
Family Mammalian PLC 0.000000108
Further Details:      
 
Domain Number 2 Region: 3-154
Classification Level Classification E-value
Superfamily EF-hand 5.64e-42
Family EF-hand modules in multidomain proteins 0.0029
Further Details:      
 
Domain Number 3 Region: 494-617
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-28
Family PLC-like (P variant) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5C2C1
Sequence length 618
Comment (tr|G5C2C1|G5C2C1_HETGA) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03698 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLLTWFFSKIQDEFRGGKINVERTYKLLEKLDIQCNYVHVKHIFKDNDRQKQGKITIEEF
RSIYRIIAHREEIVEIFNVYSENRRILFESNLIQFLTQEQYEIETTESIASEIIQKYEPI
DEVKKAHQISLEGFTRYIYSSECLLFKQECTKVYQDMTYPLNDYFISSSHNTYLVSDQLV
GPSDLWGYVSALVKGCRCLEIDCWDGSQAEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
EYPVVLSLENHCSTAQQEVMAGILQTTFGDSLLSDILDDFPDSLPSPEALKFKVLVKNKK
IGTLQETRERIGSDKHETYENLLSRDSQGKETETKKALPVTLFSKKKKIRKLKIALALSD
LVIYTKAEKFRSFQYSRQYQQFNENNSIGETQARKLSKLRVNEFIFHTRKFITRIYPKAT
RADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPQFLRDIKSKF
NPNDSIKDNDPIAITIRLISGIQLPLSGSSSHKPDTLVIIEVFGVPNDHMKRQTRVIKKN
AFSPRWNETFTFIIQVPELALLRFVVENSGLIAGNEFLGQYTLPVLCMSKGYRRVPLFSR
SGESLEPASLFVYVWYVR
Download sequence
Identical sequences G5C2C1
HGL_H00000266505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]