SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C6S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C6S3
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily SAP domain 2.38e-16
Family SAP domain 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5C6S3
Sequence length 595
Comment (tr|G5C6S3|G5C6S3_HETGA) E3 SUMO-protein ligase PIAS1 {ECO:0000313|EMBL:EHB17234.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09948 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELYRRRFPQKIMT
PADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHP
VHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQISSSMDISGTK
CDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPTYSMAVYLVKQLSSTVLLQR
LRAKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQC
FDATLYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPM
RSKKEVQEVSASYNGVDGCLSSTLEHQVASHNQSSSKNKKVEVIDLTIDSSSDEEEEEPS
AKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPM
PYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAG
GSTSLPATNGSSSGSNSSLVSSNSLRESHSHTVASRSSTDAASVFGIIPDIISLD
Download sequence
Identical sequences G5C6S3
HGL_H00000249636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]