SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C6V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C6V9
Domain Number 1 Region: 58-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5C6V9
Sequence length 221
Comment (tr|G5C6V9|G5C6V9_HETGA) Max dimerization protein 1 isoform 1 {ECO:0000313|EMBL:JAN96256.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_05844 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MATAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKQRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYASSGLKRIKLQDSRQTCLGL
Download sequence
Identical sequences G5C6V9
XP_004849975.1.39548 HGL_H00000264444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]