SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C8D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5C8D9
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000155
Family HLH, helix-loop-helix DNA-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C8D9
Sequence length 98
Comment (tr|G5C8D9|G5C8D9_HETGA) Class E basic helix-loop-helix protein 23 {ECO:0000313|EMBL:EHB17800.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09739 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGSPSVRKLSKIATLLLAKNYILMQAQALDEMRRLVAYLNQGQGLAAPVAPAPLTPFGPT
AASYTIFIHCLPYPQQPAAGLRLTPGTRWLAKQKQSAE
Download sequence
Identical sequences G5C8D9
HGL_H00000359371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]