SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5C983 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C983
Domain Number 1 Region: 10-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000154
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Weak hits

Sequence:  G5C983
Domain Number - Region: 515-563
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000483
Family PLC-like (P variant) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C983
Sequence length 987
Comment (tr|G5C983|G5C983_HETGA) Centrosomal protein of 120 kDa {ECO:0000313|EMBL:EHB18094.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_13452 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVSKSDQLLVVVSILEGRHFPKRPKHMLIVEAKFDGEQLATDPVDHTNQPEFATELAWEI
DRKALHQHRLQRTPIKLQCFALDPVSSAKETVGYIVLDLRTAQETKQAPKWHQLLSNKYT
KFKSEIQISITLETDTKAPVDSFKAKGAPPRDGKVPASLPGLDPKDLVAVLNEEGGYHQI
GPAEYCTDAFIMSVTIAFATQLEQLIPCTMKLPERQPEFFFYYSLLGNDVTNEPFNDLIN
PNFEPERASVRIRSSVEILRVYLALQPKLQIHLCCGDQSLGSTEIPLHGLLKRGSTEINQ
HPVTVEGAFILDPPNRAKQKLAPVPLELAPTVGVSVALQREGINCQASIELKTQNGHEPE
LSKKRVLSPVKEKTLTGPKSPSISPAAPPNQTPPAKDDATESEVESLQYDKDLKTHVKGT
SSSVPASLAQPVAASKASETASAQKIAVPATSHHFCFSIDLRSIHGLELSFPVNCILRYS
YPFFGSAAPIMTNPPVEVRKNMEVFLPQSYCAFDFATLPHQLQDTFLRIPLLVELWHKDK
MSKDLLLGISRIQLSNILSSEKTRFLGSNGEQCWRQTYSESVPVIAAQGSNNRIVDLSYT
VTLEDYGLVKMREIFVSDSSQGLPAVQQKPSSLPPAPCPSEIQTEPRETLEYKAALELEM
WKEMQEDIFENQLKQKELAHMQALAEEWKKRDRERESLVKKKVAEYNILEGKLQKTLIDL
EKREQQLASTESELQREKKELQSEREQNLKELQDSVRRVREDCVHQVELERLKIRQLEED
KHRLQKQLLDAENKNKTLEKEFQQFKDQQSNKPEIRLQSEINLLTLEKVELERKLESATK
SKLHYKQQWGRALKELARLKQREQESQMARLKKQQEELEQMRLRYLAAEEKDTVKTEQQE
LLDIRNELNRLRQQEQKQYQDSREIASGKMDGLRGSALEEGLDDYLTRLIEERDTLMRTG
VYNHEDQIISELNRQIREVLAKNNASN
Download sequence
Identical sequences G5C983
HGL_H00000303058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]