SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C9I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C9I9
Domain Number 1 Region: 65-129
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000931
Family Ribosomal S5 protein, N-terminal domain 0.0047
Further Details:      
 
Domain Number 2 Region: 140-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000157
Family Translational machinery components 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5C9I9
Sequence length 254
Comment (tr|G5C9I9|G5C9I9_HETGA) 40S ribosomal protein S2 {ECO:0000313|EMBL:EHB18200.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11733 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPQVQLKGALGPDLWGPGEPGFHRGFSSGFKAVGAVGAAGAWAEPFRLMARRLRTRISVT
KQGRLVTHLRIKSVQKQTRAGQQTRFKAFVAIGDYNGHCDLGVKCSKEVATATHGAIFLA
KLLIFPVQRGYWRNKIGKPHTVPCKVTGRCGCVSVSDPCLHRCCHCLSPVPKKLLLMADI
ADCYTSIRGCTATLRNFTKGPFDAISKDYSYLTLDLWKEPVFTKFRYQEFSDHLVQTHTR
VSVQRTQAPAMATT
Download sequence
Identical sequences G5C9I9
HGL_H00000341885-7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]