SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5C9Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5C9Z1
Domain Number 1 Region: 569-855
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-50
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 2 Region: 73-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.32e-37
Family DnaQ-like 3'-5' exonuclease 0.013
Further Details:      
 
Domain Number 3 Region: 933-1059
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-26
Family RecQ helicase DNA-binding domain-like 0.00000796
Further Details:      
 
Domain Number 4 Region: 1123-1207
Classification Level Classification E-value
Superfamily HRDC-like 2.99e-18
Family HRDC domain from helicases 0.0000232
Further Details:      
 
Weak hits

Sequence:  G5C9Z1
Domain Number - Region: 453-585,617-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0013
Family Tandem AAA-ATPase domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5C9Z1
Sequence length 1411
Comment (tr|G5C9Z1|G5C9Z1_HETGA) Werner syndrome ATP-dependent helicase {ECO:0000313|EMBL:EHB18352.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_06043 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MNEKKLETISQQRKFPEWMSMQNKGCAIEGKKAHIQKSVFEDDLPFLEFTGSIVYSYEAS
DCSFLSEDISMSLSAGDVIGFDMEWPPIYNKGKLSRVALVQLCVSESKCYLFHISSMSVF
PQGLKMLLENETIKKAGVGIEGDQWKLLRDFDIKLKSFVELTDVANQKLKCMEIWSLNGL
VKHLFGKQLLKDKSIRCSNWSIFPLSEDQKLYAATDAYAGLIIYQKLESLGDAIQMFDTN
KVEEILPSEMKKQLTAISEEVMDLANHFPDTCRKLENPQRVSIILKNISENLYSLRKMMF
ASTNTEPELRPRSNFKLSSLEDSTAGGQQQKQTREHKIFTRVKDETWETTLDKFIKHDGE
GVLGNKMKQEGDGSEDGIKDNKLKENMERTCLMSLDNTEYELQILEQQAQEKNLSDVSFQ
TAEVLNKKETYFLHSLRLSPSDNEKDSSYIIESDEDLEMEMLKSLENLNSDAIETIHSEC
SEIRGNLSLPTEEDEDKNEAFEEEEDHFLPEPNAKQVICLKTYFGHHSFKPVQWKVIHSV
LEERRDNVVVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLEMSNIPACFLG
SAQSKNVLEDVKLGKYRIIYITPEFCSGNLDLLQHLEANIGITLIAVDEAHCISEWGHDF
RSSFRTLGSLKTALPLVPIVALTATASSSIQEDIIHCLKLSNPQITCTSFDRPNLYLEVG
RKTGNILQDLQPFLVKKTSSEWEFEGPTIIYCSSRKMTEKVTAELRKLNLACGTYHAGMS
FNTRKDVHHRFMRDEIQCVIATIAFGMGINKSDIRKVIHYGAPKEMESYYQEIGRAGRDG
LQSSCHVLWAPADFNLNRHHFIEIHNEKFRSYKLKMVAKMEKYLHSSRCRRQIILCHFED
RQLQKASLDIMGTENCCDNCRSRLNHCHSINDSSDTSQDFGPQAFLLLSAVDILQGKFGI
GVPILFLRGSSSQRLPGPFRRHNLFGAGKDQTESWWKAFSRHLVTEGFLVDVPGGNKFVK
ICTLTAKGRNWLFKANAESPQRLILQANEELWPKKFLLPSASTVSLGIEHHPSNQIPIEL
TAEKESNLEKMYSYKALDKISSGINIPKKSIMVSSEPVISAQEQKTQSVLYGKLVEARQR
HANKMDVPPAILATNKILLDLAKMRPTTVENVKQIDGVSEGKATMLAPLLEVIKHFCQAN
SVQADLFSNTKSQEQKKSLEMKNENCSLPKCVAVTYSLFQEKKMSLDSIAKDRILPLTAV
GMHLAQAVKAGYSLDMERAGLTPEIQKIIADVIRNPPINSDMSKIKLIRMLVPENIDTYL
IHMVIEILETDHDNRLLCQPSSDSSIKRCFPNSEESCSSSKRSKEDVGTNTKMSPATSKR
NLPEWFTKGNETIVDTSKKPVAKTKKTGLFS
Download sequence
Identical sequences G5C9Z1
HGL_H00000298139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]