SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5CB18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5CB18
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-32
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 100-180
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.83e-16
Family HSP40/DnaJ peptide-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5CB18
Sequence length 246
Comment (tr|G5CB18|G5CB18_HETGA) DnaJ-like protein subfamily A member 1 {ECO:0000313|EMBL:EHB18729.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17111 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVKETTYYDVSGVKPNATQEELKKAYRKLALKYHPDKNLNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQASKEGGAGGGFGSPVDIFDMFFGGGGRMQRERRGEDLFMCMDIQLVEALC
GFQKPISTLDNRTIVITSHPGQIVKHGDINCVLNESMTIYRRPYEKGGLIIEFKVNFPEN
GFLSPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPKQERQRHYNGEAYENDEHHPRGG
VQCQTS
Download sequence
Identical sequences G5CB18
HGL_H00000369127-9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]