SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E5W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E5W1
Domain Number 1 Region: 2163-2318
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000142
Further Details:      
 
Domain Number 2 Region: 2011-2163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.77e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000189
Further Details:      
 
Domain Number 3 Region: 21-204
Classification Level Classification E-value
Superfamily Cupredoxins 1.55e-46
Family Multidomain cupredoxins 0.0000192
Further Details:      
 
Domain Number 4 Region: 392-579
Classification Level Classification E-value
Superfamily Cupredoxins 1.82e-43
Family Multidomain cupredoxins 0.000053
Further Details:      
 
Domain Number 5 Region: 1865-2009
Classification Level Classification E-value
Superfamily Cupredoxins 3.56e-42
Family Multidomain cupredoxins 0.0000753
Further Details:      
 
Domain Number 6 Region: 583-723
Classification Level Classification E-value
Superfamily Cupredoxins 8.59e-36
Family Multidomain cupredoxins 0.0001
Further Details:      
 
Domain Number 7 Region: 1683-1854
Classification Level Classification E-value
Superfamily Cupredoxins 2.6e-35
Family Multidomain cupredoxins 0.0000723
Further Details:      
 
Domain Number 8 Region: 213-344
Classification Level Classification E-value
Superfamily Cupredoxins 1.08e-30
Family Multidomain cupredoxins 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5E5W1
Sequence length 2323
Comment (tr|G5E5W1|G5E5W1_BOVIN) Coagulation factor VIII {ECO:0000313|Ensembl:ENSBTAP00000036581} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=F8 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MHIKLSTCFFLCLWPCSFSAIRRYYLGAVELSWDYMQSELLSELHVNTRFPPRVPKPFPF
NTSVMYRKTVFVEFTDQLFNIAKPRPPWMGLLGPTIQAEVYDTVVITFKNMASHPVSLHA
IGVSYWKSSEGAAYEDETSQREKEDDKVIPGKSHTYVWQILKENGPTASDPPCLTYSYLS
HVDLVKDVNSGLIGALLICREGTLIKERTQTLHKFVLLFAVFDEGKSWHSGKNESLTRVM
DSASALHTINGYINRSLPGLIGCHKKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQAS
LEISPITFLTAQTVLMDCGQFLLFCRISSHQHDGMEAYVKVDSCPEEPRLWMKNNQEEDY
DDGLDDSDMDVVRFDGDSAPPFIQMRSVAKKHPKTWVHYIAAEEDDWDYAPSVLTTSDRS
YKSLYLNHGPQRIGRKYRKVRFIAYTDGTFKTREAIQHESGILGPLLYGEVGDTLLIIFK
NQASRPYNIYPHGITDVSPLHSGRFPKGVKHLKDMPILPGEVFKYKWTVTVEDGPTKSDP
RCLTRYYSSFINLEKDLASGLIGPLLICYKESVDQRGNQMMSDKRNVILFSVFDENKSWY
LTENIQRFLPNGVQPQDPEFQVSNVMHSINGYVFDSLQLSVCLHEVAYWYILSVGAQIDF
LSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWVLGCHNSDFRNRGMTALLKV
DSCDRNVGDYYDTYEDIPTLLSDDNVIEPRSFSKNSRYPSTRQKQFKPTMTPENDMEKID
PQSGEKMQLLTEQSVSSSDLLMLLGQNPTPHRLSLSDLQETRNEATDHLPGPTERIKGPS
PSEVAHLRPELHHSGERVFTQEPELPVRLNENLGTTIMAELNKLNLKISSSSNNLMPLPT
IPSDKLSAGTKKTGSFGPPNMPVNFNSQLGAIVFGKNLSHVIGSRVPLGLSKEDNNSKLL
EAALMNSQESSLGENALSLESDRLFKEERVHGPVSLNKDDALFKVNISLVKTDKAPANST
TNRKTHIDDPTVLIENSTSVWQDIVIDSNTNFQEVTSLIHDELFMHKNTTSFGLSHMSNK
TTSSKKREMIHQEKEGPKPLDTKYPDTPFFKTLFLPDSTNVIKRTHDKNSLSSGQRPSPK
QLTSSVSENSVKDQNVLSEKNKAVAGEDEFSNNTSLKEMIFPNTKSIVLTNLANVQENDT
DNQGKKSQEETEKKETLIPENTVLPQVYTVIGTKNFLKNLFSLSTKQNVRGLDEETYTPG
LQDNRSLSDSAKRARIHAAHFSKGRVEANVEGLGNQTKQMVEKSPSTTKLSPIPSQQDAV
PHRDKRGLKQSRLPREEVKLERGVTLNDTSTQWSKSMKHLTQGTFTQIEHNKMEKRTITQ
SFLPDCSLRSHRSIRPTDVTKIPPQHNSSHPPASTYGYNLGASHSGVQETSHFLHGAKKN
NLSLAFLTLEVIGSQRKSSTPGKQATNPLMYKKLENMFLLKPGLSEASGKVVHQEDLPTK
TSKVSPAHLDLREEIFLQKTQGLVKLNKVYRTGKVPSLKWTTESSEEIPSKLLGLLAWDN
QSATLIPKEDWKSLERSHKLTSLKTKDITLPLDPSENYYSIAVTNEGEDKAQREAPWPKQ
GGTGRVCCQNPPILKRHQREITLTTFQPEPDKTDYDDTLSIETKREDFDIYGEDENQDPR
SFQKRTRHYFIAAVERLWDYGMSRSPYALRNRSQNGGVPQFKKVVFEEFTDGSFTQAIYR
GQLNEHLGLLGPYIRAEVEDNIMVTFKNQASRPYSFYSSLISYNGDQRQGAEPRKKFVKP
NETQSYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDLHSGLIGPILICRVDTLSAAHGR
QVTIQEFALFFTIFDETKSWYFAENMARNCGAPCHVQPEDPTFQEKYRFHAINGYVMDTL
PGLVMAQHQRIRWYLLSMGSNENIHSIHFSGHVFTVRKTEEYKMAVYNLYPGVFETVEML
PSKVGTWRIECLIGEHLQAGMSTLFLVYSKECQIPLGMASGRIRDFQITASGQYGQWAPK
LARLHYSGSINAWSTKDPSPWIKVDLLAPMIIHSILTQGARQKFSSLYISQFIIMYSLDG
QRWQGYRGNSTGTLMVFFGNVDSSGVKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGC
DLNSCNMPLGMENKAISDTQITASSHLRNMFATWSPSQARLNLQGRTNAWRPQVNNPKEW
LQVDFQKTMRVTGITTQGVKSLLTSMYVKEFLISSSQDGHNWTPFLQNGKVKVFQGNQDS
FTPVVNALDPPLFTRFLRIHPRSWAHHIALRLELLGCEAQQQY
Download sequence
Identical sequences G5E5W1
ENSBTAP00000036581 XP_005227696.1.76553 ENSBTAP00000036581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]