SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E621 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5E621
Domain Number - Region: 111-157
Classification Level Classification E-value
Superfamily EF-hand 0.00128
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5E621
Sequence length 1243
Comment (tr|G5E621|G5E621_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000046984} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
ASRAVPPKCVSSSKWYGRQSQPKPCGAAGGAPGLLEQPAIPSARSQLRGSASLESVESLK
SDEEANSAKEPQNELFEAQGQLPTWGSEVFGSPKPCSHSFDTPESQVWGLWEELGVGISG
HLPEQELALVCQSIGLQGLVKEEPEDLFNKLDQDGDGRVLEELQLGLFNHGSPRPLELAP
LVKPSRSWSRYQVPEESVGQTTTSSLVSVCSGPRLFCSVDDGSGFAFLEQIISFGAQEGV
HNGREVLQSLDFSVDEKVNLLELTWALENELMMVGGAAQQAALACYRQDLSFCQEQVEQM
VRERDKARQDLEKAEQRNLEFVKETDDLHSAREQLTEEKVRHLEQSYRGRLSLLRSEVEV
ERELFWEEARRQRAGLEEDLRKRLQAKETGLHEKLTLALKEMTEVVEKLSDSEKLVLKLQ
NDLEFVLRDKLEPQSTELLAQEERFSEILKEYELKYRDLQDHSDKLQAALESLQAQAAPS
RHGRLPPGHGRGTVTFVGDSAPASIETEIMLEQVKEHYQDPAGDQGLSPQVNDHEREMEE
TKRAFAEERRELERAFQLEVGVLQGQKAKLVMLQAESQEVVQGLRQQLQRQVLGPRPLEG
LCQEPPSTTQEMTWVTAGRHSSRRVLQRQRLRELLCPLSGQRTLAHRTRRCVQLRHPPPV
PPRRLDCLSPSRPCCRPLPQTRGSPMVWSLGRAEVVLGLTSGRASGERVDPLLQLRLRSK
AGLGPSAPGVHIRPLAHSGPSVREQPSGHMPSLPSVSGTSSGLAQEPVLSSSSTQPPGPG
AVLGLSPLLLTRGTPWLVGPTANVTVPVSVVSGSLDRVSWAPATCCHRGHGRFSNLQTGR
CTEWSSAWMPALPGNQPSTRTPGVVSPHRYSCSSVAHHWSYLPGRLRASEAKGSRQTWPG
QPLEGIPLQQLCEDSHPASCIGASYEHADISVKNLLSRIELEKLSEENTLLKNELGRIRQ
EFEASERTEAAQRKEIEVLKRDKEKACSEMEELCTQSQKCRDELSQLNHRVLQLGEEAST
HQTQSEKSPVTVQLLTHGLEEAELREELQGNQIQKLELDRVTQDHQSLRLAQSQLREALE
ESGPGLYGATQRLQLARLQHAQQVRQLREEMAQLVPAVRVAELQRLLEGERRGAWWLQAE
AQEAHEKQLKATEEWVEEVETILKNMEVLLQEKVGELKEQFEKNTRSDLLLKELYVENAH
LTKALQVTEEKQRGAEKKSQFLEEKLRALNKLLSKIATASLAV
Download sequence
Identical sequences G5E621
ENSBTAP00000046984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]