SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E698 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E698
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.58e-29
Family SCAN domain 0.00045
Further Details:      
 
Domain Number 2 Region: 193-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 229-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5E698
Sequence length 281
Comment (tr|G5E698|G5E698_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000049589} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PQDTLMENSDCDQENWHVRFRTFSSSEESDPVEDLRRLRELCHLWLRPDLHTKEQMMDRL
VLEQFMICMPLECQVLLKESGVQSCKALEDMLRNKQKPKNWVEAKAGDMDNERDPCREPQ
PPMTVIPPEDGQEGSPELQNLPGATNLSREQVRACKQVEESQAFFLITVRMKIIHLCPSE
TWSIRSRYEADGELILHQRTHTGERPFQCDICAKGFIQLSHLRVHEQIHTGKKPYSCDLC
LKKFTHDSTLRAHKRTHTQEKPFRCEHCDRAFSHRGNLSVH
Download sequence
Identical sequences G5E698
ENSBTAP00000049589 ENSBTAP00000049589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]