SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E7Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E7Q0
Domain Number 1 Region: 76-162
Classification Level Classification E-value
Superfamily Virus ectodomain 1.39e-17
Family Virus ectodomain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5E7Q0
Sequence length 271
Comment (tr|G5E7Q0|G5E7Q0_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000019087} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
WYFRGKILWFALPSNWGGTCALVQLAIPFTLAFEKGRSKRSLEACRVSFDDAIYIDSIGV
PRGPDEFKVRNLIAAGFESLISWVMINKYVDQINYIYYNIIQSAMKRIAEQLDATSRMAW
KNRIALDMMLVEKGCVCMMLGTCCCTSIPNNAALDGTITKALQGLTTLAGELAENSGIDT
YIIGWLESWFGKWKGVIVSTFASLIIAAGALTAIGCCIIPCVRGLIQRLIKTALLKQTPM
EPPYLDKMMILEEMENKESEEELNEWPSEWP
Download sequence
Identical sequences G5E7Q0
ENSMGAP00000019087 ENSMGAP00000019087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]