SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E7Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E7Q6
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-49
Family Calponin-homology domain, CH-domain 0.00000032
Further Details:      
 
Domain Number 2 Region: 203-261
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.18e-20
Family EB1 dimerisation domain-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5E7Q6
Sequence length 275
Comment (tr|G5E7Q6|G5E7Q6_MELGA) Microtubule associated protein RP/EB family member 1 {ECO:0000313|Ensembl:ENSMGAP00000019093} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=MAPRE1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
VLLNVFHTVFWTSDNLSRHDMLAWINESLQLTLTKIEQLCSGAAYCQFMDMLFPGSVALK
KVKFQAKLEHEYIQNFKVLQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANY
DGKEYDPVAARQGQETMAPNLVAPVVNKPKKPLGTGSAGRNEFKMISSLSPQRPIVAQRT
PATPKGSTGMVKKAAGDDESAGLIEQINVLKLTVEDLEKERDFYFGKLRNIELICQENEG
ENDPVLQRIVEILYATDEGFVIPDEGAPQEEQEEY
Download sequence
Identical sequences G5E7Q6
ENSMGAP00000019093 ENSMGAP00000019093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]