SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E8E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E8E0
Domain Number 1 Region: 91-223
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.19e-45
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5E8E0
Sequence length 230
Comment (tr|G5E8E0|G5E8E0_MOUSE) Regulator of G-protein-signaling 17 {ECO:0000313|Ensembl:ENSMUSP00000065825} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_14635 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGFFSKKLLLRWQLGSEAADMRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSC
LTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFRE
FLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVIN
RSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES
Download sequence
Identical sequences G5E8E0
ENSMUSP00000065825 ENSMUSP00000113519 NP_001155294.1.92730 ENSMUSP00000065825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]