SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5E9B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5E9B7
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 4.71e-79
Family Sec7 domain 0.00000000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5E9B7
Sequence length 292
Comment (tr|G5E9B7|G5E9B7_HUMAN) Pleckstrin homology, Sec7 and coiled-coil domains 2 (Cytohesin-2), isoform CRA_c {ECO:0000313|EMBL:EAW52351.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_1998017 OC=Catarrhini; Hominidae; Homo.
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGTGPGEDVEAALVYPHRQLPLLL
Download sequence
Identical sequences G5E9B7
ENSP00000375753 ENSP00000375753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]