SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5EA42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5EA42
Domain Number 1 Region: 140-302
Classification Level Classification E-value
Superfamily RNI-like 1.22e-45
Family 28-residue LRR 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5EA42
Sequence length 307
Comment (tr|G5EA42|G5EA42_HUMAN) Tropomodulin-2 {ECO:0000313|Ensembl:ENSP00000437743} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=hCG_1641013 OC=Catarrhini; Hominidae; Homo.
Sequence
MLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKP
IETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVR
NVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALET
NTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTL
TEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKK
RVEADRR
Download sequence
Identical sequences G5EA42
ENSP00000437743 ENSP00000437743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]