SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5ECR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ECR9
Domain Number 1 Region: 137-360
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-31
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 20-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.48e-28
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5ECR9
Sequence length 370
Comment (tr|G5ECR9|G5ECR9_CAEEL) UNC-55a isoform {ECO:0000313|EMBL:ABQ96204.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F55D12.4 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MQDGSSGAASLGNSSPDATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRAT
KNCAIDVQHRNQCQYCRLTKCIRMGMRKEGRRSNETQTAVSAVQRGRLPVTMPSLFPPNM
FLRSPFPFMSVPFNPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTSMSNLVKGDQLIL
LRHSWTPIFIFALAQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERV
FDEPQFQGFQAKIDKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVD
EYCKMNKRSERYHQICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSDLLITPPPPTL
PFFPQLPSRN
Download sequence
Identical sequences G5ECR9
NP_001122482.2.50509 F55D12.4a F55D12.4a F55D12.4a 6239.F55D12.4a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]