SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5ED42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ED42
Domain Number 1 Region: 14-52,101-174
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 174-293
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000157
Family Voltage-gated potassium channels 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5ED42
Sequence length 555
Comment (tr|G5ED42|G5ED42_CAEEL) TWiK family of potassium channels {ECO:0000313|EMBL:CCD66479.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_F52E4.4 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MMFILQQLLRFFRLKNFEHAKPFTLHCSLLMLVLLYSFLGGFIFDRIETNAHAEMKRNER
INRTACVSQILHSIHRWSHNQTHKVQYAEDIADCFEPEKDERSEWNFVTATLYGFGIVTT
LGYNRIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMS
KASLAGKIYKESSIQVTSLALLCVFLIYVAVGALLLPLLNGELDFFNGLYFNFLCLTAID
FGQLVPIRVELLPITFLYVCIGLAITTIAINIGSEYMKKLHYWGKKMKNAAQTRIWFGGK
TLKVRDLLHAVGKKCGVEPGMIDALDLENVVERTIAMQEGREPPEDLNDEPPREPSPRSI
IHSPCSTRPSNPPMSPPSPREDHPFIFKMDAPAPRSPLPLPAYELDIKKPIFQALSNEFM
NQSAQEKLFNDLDTFQIEINTELVEDHKCESVIIIEPPATFEDMTIQHSLCVEDYEREEK
VPKRFREKKEMYGRDPRKLYETYQEEWDRLERLSDRKHGPRRKSVLNLSNCSPERSVSPS
PIRHSLTGEGHRRDS
Download sequence
Identical sequences G5ED42
6239.F52E4.4 F52E4.4 F52E4.4 NP_508526.2.50509 AAC32856 F52E4.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]