SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5EDQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5EDQ5
Domain Number - Region: 34-92
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00224
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5EDQ5
Sequence length 122
Comment (tr|G5EDQ5|G5EDQ5_CAEEL) Short coiled-coil domain-containing protein UNC-69 splice variant T07A5.6b {ECO:0000313|EMBL:AAX12521.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=CELE_T07A5.6 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSQKTEQDDIPLADDDDTVTIISGGKTPRAAQPLPKEEPPEDPEEKARMITQVLELQNTL
DDLSQRVESVKEESLKLRSENQVLGQYIQNLMSSSSVFQSSQPSRPKQDDSVHDDDFGEY
EY
Download sequence
Identical sequences G5EDQ5
T07A5.6b T07A5.6b NP_001022753.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]