SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5EGP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5EGP2
Domain Number 1 Region: 14-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-18
Family Nuclear receptor 0.0014
Further Details:      
 
Domain Number 2 Region: 128-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000115
Family Nuclear receptor ligand-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5EGP2
Sequence length 326
Comment (tr|G5EGP2|G5EGP2_CAEEL) Nuclear Hormone Receptor family {ECO:0000313|EMBL:CAB03927.2} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=C27C7.4 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSTTVGRPSNEIASCQVCHSTERTRLYFGITSCAACAAFFRRSDGIRYMCTATNSCTISH
DMKFFCRACRYTSCIRAGMVMSRNALATARKAPNNIIPREPTPRSVPSLEEVDGFSKILN
ISNGDLLKYYVKEVESIMAQQRYGEQKNALQVKSVNDLMIVTAYQEGTSLESCFNCPGVD
ILYNEDVEVVHKYFKFSNTWIDSLLAPTSPLDPSCNERISEFIHLLKSTLGSTLAQLNLN
IIEYAAFKSFCIWKLVYHKTSISMKIVAQEHYEGVTSALRKYYRKNIKMSELEMATRIGD
ITLQIITVSNLYNDMARMYHQTGLQL
Download sequence
Identical sequences G5EGP2
NP_492921.2.50509 NP_492932.1.50509 C27C7.4 ZK1025.10 6239.C27C7.4 6239.ZK1025.10 C27C7.4 ZK1025.10 C27C7.4 ZK1025.10 ZK1025.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]