SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5EHS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5EHS6
Domain Number 1 Region: 70-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-56
Family Peptidase A4 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5EHS6
Sequence length 290
Comment (tr|G5EHS6|G5EHS6_MAGO7) Aspergillopepsin-2 {ECO:0000313|EMBL:EHA46561.1} KW=Complete proteome; Reference proteome OX=242507 OS=blast fungus) (Pyricularia oryzae). GN=MGCH7_ch7g198 OC=Magnaporthe.
Sequence
MKATLVTALVGATAVNATSFRPAATQQHARPQSQVFDRSLHRADPVAVAGSNSRVFAASV
MSTAAAAEKPPVVGGAYLSSSEITSVGGRFTVPRATQPTKGAIAGQDIEYGASFWVGIDG
VNCTTGTLRAGIDIFWSSRGESYHAWYQVSADSSKDFLAGEIDVAPGDELHVTATASGGN
GTLVVNNRSTNQTVERHLAPGEKLCRSEAAWLIEDFVLVQAIGAPVALVNFTDVTFGDMK
TTMQCGSSERAEPVNLDDVKVMDVEVEEQGGKLTDCQMTGVDQMTCKRFA
Download sequence
Identical sequences G5EHS6 L7HRP4 L7JAC0
MGG_09032T0 148305.A4RCS3 XP_003721304.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]