SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5IY37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5IY37
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000185
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5IY37
Sequence length 257
Comment (tr|G5IY37|G5IY37_CROWT) Uncharacterized protein {ECO:0000313|EMBL:EHJ15147.1} KW=Complete proteome OX=423471 OS=Crocosphaera watsonii WH 0003. GN=CWATWH0003_0192 OC=Aphanothecaceae; Crocosphaera.
Sequence
MEWLEISGSSVLVPRYPIAIIHFLGGAFVGTAPNFTYRWLLEELAKEGYAIIATPFVNTF
DHLAIARNVLNRFEGILDRLQTNNSLGQGYLPIYGIGHSMGCKLHLLIGSLFSVERAGNV
LISFNNYPVKKAIPFLEQLDIENYLNLEFTPSPDETKLIIEKDYLVRRNLLVKFTDDNID
ETKILEPILDDKYPNLIALQTLSGNHLTPLSQDIKWEAGEIFTPLDAVGQWVKQAFSRDL
YRLKNEILRWLNPGRIV
Download sequence
Identical sequences G5IY37 T2IHD2 T2J3P6 T2JCE6 T2JXW8
WP_007308872.1.10559 WP_007308872.1.26817 WP_007308872.1.54612 WP_007308872.1.82155 WP_007308872.1.98453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]