SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7IF44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7IF44
Domain Number 1 Region: 97-279
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.94e-60
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 25-95
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0000000000000017
Family Domain of poly(ADP-ribose) polymerase 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7IF44
Sequence length 291
Comment (tr|G7IF44|G7IF44_MEDTR) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1g088400 OC=Trifolieae; Medicago.
Sequence
MLVHHVYMNFSSTISFHYNWIAIFNNWLWVCCREFYTIIPHDFGFKNMREFVIDTPQKLI
HKLEMVEALAEIEVATKLLKDDAEMQGDPLYAYYKCLRCELVPVESGTEEFSMIESYMMN
THAKLHSDYTVEIVQIFRTSKEGEAERFRKFSNTKNRMLLWHGSRLTNWTGILSQGLRIA
PPEAPVTGYMFGKGVYFADMFSKSANYCHPTPTAADGVLLLCEVALGEMAELLTGDHDAD
RLPEGKLSTKGVGATAPDFSKAQELEDGLIVPLGKPKTNSRIKLQGNLIAQ
Download sequence
Identical sequences G7IF44
Medtr1g088400.1 XP_003591512.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]