SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7IK52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7IK52
Domain Number 1 Region: 485-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-79
Family Protein kinases, catalytic subunit 0.0000567
Further Details:      
 
Domain Number 2 Region: 72-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-29
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  G7IK52
Domain Number - Region: 344-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Anti-platelet protein 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7IK52
Sequence length 817
Comment (tr|G7IK52|G7IK52_MEDTR) S-locus lectin kinase family protein {ECO:0000313|EMBL:AES63662.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_2g011170 OC=Trifolieae; Medicago.
Sequence
mkvlivifvyvclsmldkasyaadtltqnssiidgqelisagqifclgffspgsskkyyl
giwyknitpqtvvwvanrekplnnssgnltigadgnillvdgvgnkiwytnssrsiqepl
aklldsgnlvlmdgknhdsnsyiwqsfdyptdtmlpgmklgwdkasgldryltswksadd
dpsygsftynfdhkefaelvihqgknitfrsgiwngvrfnsddwtsfigvtafkpqlsvt
knevvywdepgdrlsrfmmrddglleryiwdssivkwtkmyearkdlcdnygacgingvc
niddvpvycdclkgfkprsqdewnsfnrsggcirktplncteadrfqklssvklpmllqf
wtnssmsleeckveclkdcsctayansvinegphgcliwfgdlidirlfisedslqldly
vrlaaseiestasaskrrkmaliisvsmavfvlciifyicmkyakvrkqkttadlghrnq
nekqasplfdidtilaatdsfsienkigqggfgpvykgilaqgqeiavkrlsktskqgvt
efmnevglvaklqhrnlvsvlggctygnermlvyeympngslnhfifdptqgkflqwrkr
ydiimgvargllylhqdskltiihrdlktsnilldseliakisdfgvshilegdssavtt
nkivgtigymspeyavngllslksdvfsfgvivleilsgirnnhfknqdhphnllgqawi
lwkegralefmdanldltsipsellrclqigllcvqkfpedrpdmssvvfmlgnesiala
qpkkpgffseeiefhessekdtfsnntmtitlleard
Download sequence
Identical sequences G7IK52
XP_003593411.1.50012 Medtr2g011170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]