SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7KSB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7KSB1
Domain Number 1 Region: 23-116
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.98e-29
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 2 Region: 183-291
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000189
Family Calsequestrin 0.064
Further Details:      
 
Domain Number 3 Region: 423-547
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000034
Family Calsequestrin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7KSB1
Sequence length 558
Comment (tr|G7KSB1|G7KSB1_MEDTR) DnaJ heat shock amino-terminal domain protein {ECO:0000313|EMBL:AES79532.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_7g069480 OC=Trifolieae; Medicago.
Sequence
mtlsattlivtfaalcfllqseaktidpykvlgvdksasqreiqkafhklslqyhpdknk
akgaqekfaqinnayeilsdeqkrknydlygdekgnpgfeaghpggyggpggfnfrpgeq
qwgrgdqggsksfsfsfgggsgdsnsfgfglddllgnffgdfgssfrsqssqsgsksspk
sfkainsniynkeivdegmtwlllsyspslrgiqhfesiigevagtlqgalkvgsincek
evsfckelgvyprkgprlfvysykenekgslveyggdlavkdlkafcqqhlpmfskrtdl
nqldqfstaeklprvlllstkkntpviwrvlsglyrkrfafsdvqvhddsdsrvrklgvd
alpailgwlpngeklilktgvsvkdvksgvqdlskildsfekvskketssqskkeqadse
dkhiqllsrtnfealcgertpvcvigafrsskgrekleslltlvsqkslsrkpngsgssk
dsisyglldsskqqsflnafdktgykssdklliaykprkgkftvftgemtveevenfiss
vlsgdipfrethkkpvlk
Download sequence
Identical sequences G7KSB1
Medtr7g069480.1 XP_003623314.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]