SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7MJU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MJU1
Domain Number 1 Region: 134-274
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000421
Family NTF2-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7MJU1
Sequence length 329
Comment (tr|G7MJU1|G7MJU1_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH15986.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_11204 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
VEMSGLSFSEMEGCRNLLGLLDNDEIMALCDTVTNRLVQPEDRQDAVRAILVYSQSAEEL
LRRRKVHREVIFKYLATQGIIIPPATEKHNLIQHAKDYWQKQSQLKLKETPEPVTKTENI
QLFQQQVKEDKKAEKVDFRRLGEEFCHWFFGLLNSQNPFLGPPQHEWGPQHFWHDVKLRF
YYNTSEQNVTDYYGAEIVSLRLLSLVKEEFLFLSPNLDSHGLKCASSPHGLVMVGVAGTV
HRGNTCLGIFEQIFGLIRCPFVENTWKIKFINLKIRGESSLAPGTLPKPAVKFEQSDLEA
FYNVITLCGTSEVRHNVKQFLDSGTGDQV
Download sequence
Identical sequences A0A2K5VUA8 A0A2K6E1E3 G7MJU1
ENSMMUP00000028331 ENSMMUP00000028331 9544.ENSMMUP00000028331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]