SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7MNN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MNN3
Domain Number 1 Region: 53-246
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-79
Family Sec7 domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 255-370
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-34
Family Pleckstrin-homology domain (PH domain) 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7MNN3
Sequence length 390
Comment (tr|G7MNN3|G7MNN3_MACMU) PH, SEC7 and coiled-coil domain-containing protein 3 {ECO:0000313|EMBL:EHH17129.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_13453 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
SVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQI
AMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKV
LQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTC
YVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKI
PEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP
LENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKE
EWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences G7MNN3 G8F3K7
ENSGGOP00000015004 ENSGGOP00000015004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]