SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7MPD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MPD2
Domain Number 1 Region: 71-319
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-56
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000432
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7MPD2
Sequence length 391
Comment (tr|G7MPD2|G7MPD2_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH18346.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_14922 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLP
PVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRV
SGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGNPARWR
DFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRR
SHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVG
DKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDI
RWELNAMTTNSNISRPIVSSPFAYPVPLLEP
Download sequence
Identical sequences G7MPD2 G7P3Z0
ENSMMUP00000001035 ENSMMUP00000033669 9544.ENSMMUP00000001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]