SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7MR84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MR84
Domain Number 1 Region: 31-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.93e-59
Family Proteasome subunits 0.00000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7MR84
Sequence length 241
Comment (tr|G7MR84|G7MR84_MACMU) Proteasome subunit beta type {ECO:0000256|RuleBase:RU004203} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_15528 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLSSVAMYSAPGRDLGMEPHGAAGPLQLRFSPYAFNGGTVLAIAGEDFAIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRK
D
Download sequence
Identical sequences A0A2K6CC21 G7MR84 G7P4A9
NP_001247565.1.72884 XP_005551422.1.63531 XP_011749418.1.29376 ENSMMUP00000026177 ENSMMUP00000026177 9544.ENSMMUP00000026177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]