SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7MXM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7MXM0
Domain Number 1 Region: 260-431
Classification Level Classification E-value
Superfamily Fic-like 1.29e-50
Family Fic-like 0.0027
Further Details:      
 
Domain Number 2 Region: 106-178
Classification Level Classification E-value
Superfamily TPR-like 0.00000000506
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7MXM0
Sequence length 460
Comment (tr|G7MXM0|G7MXM0_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH27377.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_17560 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MMLMPMASVMAVTEPKWVSVWGRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGFYL
LRSKLDRAQHAAAKCSSPSTELSITSRGVTLLVAKTKASPAGKLEARAALNQALEMKRQG
KREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVSR
DRTLPLVEEIDQRYFSIIDSKVKKIMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTL
SEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGY
VDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEDAMNLHPVEFAALAHYKLV
YIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEAANEGDVRPFIRFIAK
CTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKPSP
Download sequence
Identical sequences A0A0D9S2R6 A0A2K5ZK84 A0A2K6C7F8 G7MXM0 G7PI52
9544.ENSMMUP00000022529 ENSMMUP00000022529 XP_001095158.2.72884 XP_005572197.1.63531 XP_005572198.1.63531 XP_005572199.1.63531 XP_008002767.1.81039 XP_008002768.1.81039 XP_011716699.1.29376 XP_011716700.1.29376 XP_011716701.1.29376 XP_011716702.1.29376 XP_011716703.1.29376 XP_011830949.1.47321 XP_015008176.1.72884 XP_015008177.1.72884 XP_015008178.1.72884 ENSMMUP00000022529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]