SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7N2A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7N2A9
Domain Number 1 Region: 136-241
Classification Level Classification E-value
Superfamily TPR-like 0.00000285
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7N2A9
Sequence length 621
Comment (tr|G7N2A9|G7N2A9_MACMU) KIF1-binding protein {ECO:0000313|EMBL:AFE77681.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_19782 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MANVPWAEVCEKFQAALTLSRVELQKNPEKEPYKSKYSARALLEEVKALLGPAPEDEDER
PEAEDGPGAGDHALGLPAEVVEPEGPVAQRAVRLAVIEFHLGVNHIDTEELSAGEEHLVK
CLRLLRRYRLSHDCISLYIQAQNNLGILWSEREEIETAQAYLESSEALYTQYMKEVGCPP
LDPTERFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHLEMFEKAAHYCHSTLKRQLE
HNAYHPIEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKISATEDTPEAEGEVP
ELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESIRK
KAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQHYVFEAKEFFQIDGYVTDHI
EVVQDHSALFKVLAFFETDMERRCKMHKRRIAMLEPLTVDLNPQYYLLVNRQIQFEIAHA
YYDMMDLKVAIADRLRDPDSHIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVL
RPAMLAKFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELS
KEMVSLLPTKMERFRTKMALT
Download sequence
Identical sequences A0A096P501 A0A2K5NK42 A0A2K6ACC4 A0A2K6B7N6 A0A2K6Q8U7 G7N2A9 G7PF59
ENSPANP00000020426 XP_010361114.1.97406 XP_011713342.1.29376 XP_011846405.1.47321 XP_011940650.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]