SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7N2R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7N2R6
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 2 Region: 41-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000026
Family V set domains (antibody variable domain-like) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7N2R6
Sequence length 342
Comment (tr|G7N2R6|G7N2R6_MACMU) Signal-regulatory protein beta-2 {ECO:0000313|EMBL:EHH19848.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_02583 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MCSMMLAPACLACLSPCFLLLVLVLVPSDASGQSSRNDGQVLQPEGPMLVAEGETLLLRC
MVVSSCADGMIKWVKVSTKDQQEIYNFKRGSFPGVIPMIQRTSEPLNCDYSIYIHNVTKE
HTGTYHCVRFDGLSEYSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGGTVFLNC
TVLGDGPPGPIRWFQGAGVSREAIYNFGGISHPKATAVRASNNDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSQEAEFTSEHATEMSPTGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDVKTTDPAEAMNTLAWSKGQE
Download sequence
Identical sequences A0A2K5VZ41 G7N2R6
9544.ENSMMUP00000021034 ENSMMUP00000021034 ENSMMUP00000021034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]