SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7N2Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7N2Z1
Domain Number 1 Region: 410-539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000137
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 601-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000299
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 635-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 703-829
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000659
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 5 Region: 346-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 310-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 269-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000056
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 680-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  G7N2Z1
Domain Number - Region: 565-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 844-870
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00392
Family PMP inhibitors 0.0039
Further Details:      
 
Domain Number - Region: 386-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7N2Z1
Sequence length 1190
Comment (tr|G7N2Z1|G7N2Z1_MACMU) Delta-like protein {ECO:0000256|RuleBase:RU280815} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_02669 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
CGASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTA
GGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQP
DSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFG
HYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPH
PGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGY
SGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGT
CQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCD
ININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINR
FQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCR
TTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHE
NINDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVND
FYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSC
LPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCEC
APGFAGPDCRININECQSSPCAFGATCVDEINGYRCVCPPGHSGAKCQEVSGRPCITMGS
VIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSCIPILDDQCFVH
PCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNI
LKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSL
IAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASE
DNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKA
RFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences G7N2Z1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]