SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7N4P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7N4P5
Domain Number 1 Region: 33-94
Classification Level Classification E-value
Superfamily BPTI-like 8.8e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7N4P5
Sequence length 99
Comment (tr|G7N4P5|G7N4P5_MACMU) Kunitz-type protease inhibitor 4 {ECO:0000313|EMBL:EHH19649.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_02353 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNVGSCYEVHFRYFYN
RTSKRCESFVFSGCDGNLNNFKLKLECDVTCVTKYKPPE
Download sequence
Identical sequences G7N4P5
9544.ENSMMUP00000023987 ENSMMUP00000023987 ENSMMUP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]