SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7NKI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7NKI8
Domain Number 1 Region: 238-377
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-31
Family Cadherin 0.00000191
Further Details:      
 
Domain Number 2 Region: 469-593
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-26
Family Cadherin 0.00054
Further Details:      
 
Domain Number 3 Region: 15-161
Classification Level Classification E-value
Superfamily Cadherin-like 5.49e-23
Family Cadherin 0.00000422
Further Details:      
 
Domain Number 4 Region: 359-478
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-20
Family Cadherin 0.00011
Further Details:      
 
Domain Number 5 Region: 148-242
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-16
Family Cadherin 0.00000303
Further Details:      
 
Domain Number 6 Region: 582-689
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000471
Family Cadherin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7NKI8
Sequence length 889
Comment (tr|G7NKI8|G7NKI8_MACMU) Neural cadherin {ECO:0000313|EMBL:EHH29236.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_09602 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
VLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQYESSEPA
DFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPALTEESVKEPPE
VEEIVFPRQLSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSV
TGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINV
IDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPS
PNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAIITVTDVND
NPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDP
NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYF
APNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIA
VLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPD
PNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYE
VPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLI
LVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVE
PDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLV
FDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Download sequence
Identical sequences G7NKI8 G7PWK0
ENSMMUP00000019908 ENSMMUP00000019908 9544.ENSMMUP00000019908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]