SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7NMW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7NMW5
Domain Number 1 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 483-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-19
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 147-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 641-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 92-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-16
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 300-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7NMW5
Sequence length 693
Comment (tr|G7NMW5|G7NMW5_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH29986.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_10550 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
ESITFGDVAIDFSHQEWEYLDLVQKTLYQEVMMENYDNLVSLAGHSISKPDLITLLEQGK
EPWMIVGEETRGECTDLDSRYEIISDGKMHLYRKQSSVTLHQRIHNGQKPYECKECQKAF
SHLTELIIHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAREKPYECEECGKVFSYPA
NLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLSRH
QSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFSHLVGHKRIH
TGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGKAFSSGHQLTAPHTFESVEK
PYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKPYKC
KECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQECG
KGFSYSHKLTIHRRVHTGEKPYECKECGKAFSVSGQLTQHLSIHSGKKPFECNKCGKSFR
FISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHASH
LIIHERIHTSDKPYECKRCGKAFRCASYLVRHERVHADGNPYMCEECGKAFNSSHELSIH
HRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences G7NMW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]