SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7NS99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7NS99
Domain Number 1 Region: 22-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-39
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 255-394
Classification Level Classification E-value
Superfamily PapD-like 1.18e-36
Family MSP-like 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7NS99
Sequence length 455
Comment (tr|G7NS99|G7NS99_MACMU) Motile sperm domain-containing protein 2 {ECO:0000313|EMBL:EHH30549.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_20280 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLDESFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHIKDQKTIS
DKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIV
IFDMPWLMNAAFKIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPP
LVDDDFQTPLCENGPITSEDETSSKEDIESDGKETLETISNEEQTPLVKKSNPTESTSKA
EENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGNTESGEKKTLMVLTNVAKNIVAFK
VRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGPAEL
TQFWKEVPRNKVMEHRLRCHTVESSKPNTLTLKDSAFNMSDKTSEDICLQLSHLLESNRK
LEDQVQRCIWFQQLLLSLTMLLLAFVTSFFYLLYS
Download sequence
Identical sequences G7NS99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]