SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7NWU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7NWU6
Domain Number 1 Region: 253-522
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-79
Family Protein kinases, catalytic subunit 0.00000000123
Further Details:      
 
Domain Number 2 Region: 114-241
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-39
Family SH2 domain 0.00000671
Further Details:      
 
Domain Number 3 Region: 77-118
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000205
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7NWU6
Sequence length 529
Comment (tr|G7NWU6|G7NWU6_MACFA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_00391 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGCVYCKKLEPAATAKEDAGLEGDFRSYGAADHYGPDPTKAQPASSFVHIPNYSNFSSQA
INPGFLDGGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGQTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLTAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLAEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIKDDEYNPCQGSKF
PIRWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMSKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT
Download sequence
Identical sequences F7BHF8 G7NWU6
ENSMMUP00000018960 9544.ENSMMUP00000018960 ENSMMUP00000018960 NP_001244986.1.72884 XP_005544320.1.63531 XP_005544321.1.63531 XP_005544322.1.63531 XP_014987804.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]