SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7NXE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7NXE3
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-48
Family Regulator of G-protein signaling, RGS 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7NXE3
Sequence length 209
Comment (tr|G7NXE3|G7NXE3_MACFA) Uncharacterized protein {ECO:0000313|EMBL:EHH50708.1} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_01576 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRAAAISTPKLDKMPGMFFSANPKELKGTAHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDILSAAEVMQWSLSLEKLLANQTGQKVFGSFLKSEFSEENIEFWLACED
YKKTESDLLPCKAEEIYKVFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK
Download sequence
Identical sequences A0A096NQB3 A0A2K5YYZ2 A0A2K6CZI9 G7MF14 G7NXE3
XP_011744745.1.29376 XP_011850472.1.47321 XP_011927113.1.92194 ENSPANP00000015207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]