SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G7P1S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7P1S9
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000785
Family DNA polymerase processivity factor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G7P1S9
Sequence length 280
Comment (tr|G7P1S9|G7P1S9_MACFA) HUS1 checkpoint clamp component {ECO:0000313|Ensembl:ENSMFAP00000007953} KW=Complete proteome; Reference proteome OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=EGM_12526 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MRFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHQDRNVEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences G7MLB7 G7P1S9
ENSMMUP00000009228 9544.ENSMMUP00000009228 ENSMMUP00000009228 XP_001088000.1.72884 XP_005549685.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]